SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6IH69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6IH69
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 3.66e-17
Family E2F dimerization segment 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B6IH69
Sequence length 229
Comment (tr|B6IH69|B6IH69_CAEBR) Protein CBG27013 {ECO:0000313|EMBL:CAR99249.1} KW=Complete proteome; Reference proteome OX=6238 OS=Caenorhabditis briggsae. GN=CBG27013 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MMRQQEKILEMMIQDAQAIIGMHFEDPIARPYNYIRKDDIRSTADANSKSIIIKSDNDVD
NHFEVQVTDPAASGCYDMIVKNKSGVKSHALLFNNEQPRGMDDEEKQKKNSYCHKIMIYX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYYANVMKKVYL
Download sequence
Identical sequences B6IH69
CBG27013 6238.CBG27013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]