SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B6W6H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6W6H3
Domain Number - Region: 12-47
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz beta-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6W6H3
Sequence length 67
Comment (tr|B6W6H3|B6W6H3_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EEB36916.1} KW=Complete proteome; Reference proteome OX=561177 OS=Anaerococcus hydrogenalis DSM 7454. GN=ANHYDRO_00153 OC=Anaerococcus.
Sequence
MPRKRPETKRSKIAKMLIEEYEPQSVQDIQEALKDLLGDTMEELLKAELDEHLGYEYGKK
HYPKYKK
Download sequence
Identical sequences B6W6H3
WP_004812379.1.93935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]