SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6WTZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B6WTZ7
Domain Number - Region: 20-34
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0549
Family Somatomedin B domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B6WTZ7
Sequence length 42
Comment (tr|B6WTZ7|B6WTZ7_9DELT) Uncharacterized protein {ECO:0000313|EMBL:EEB33561.1} KW=Complete proteome; Reference proteome OX=411464 OS=Desulfovibrio piger ATCC 29098. GN=DESPIG_01555 OC=Desulfovibrionaceae; Desulfovibrio.
Sequence
MGDQRIFFIPDLCGEIFLSPCKKRCFLKVACCIDPFISFLTT
Download sequence
Identical sequences B6WTZ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]