SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7FIT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7FIT4
Domain Number 1 Region: 2-203
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-59
Family Capz beta-1 subunit 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7FIT4
Sequence length 205
Comment (tr|B7FIT4|B7FIT4_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:ACJ84663.1} OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN= OC=Trifolieae; Medicago.
Sequence
MEAAMGLMRRIPPKHTETALSALLSLMPNHSSDLLSQVDQPLQVLCDVDCGKEFILCEYN
RDADSYRSPWSNKYHPPLEDGSLPSSELRKLEIEANDIFAIYRDQYYEGGISSVYMWEDE
NEGFVACFLIKKDGSKTGQGRRGYLEEGAWDAIHVIEVGPEEEEDTNYRLTSTVMLTLTT
NNESSGTFSLSGSIRRQMSMRLSVC
Download sequence
Identical sequences B7FIT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]