SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7GIX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7GIX4
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00029
Family Rubredoxin 0.042
Further Details:      
 
Domain Number - Region: 58-94
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz beta-1 subunit 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7GIX4
Sequence length 111
Comment (tr|B7GIX4|B7GIX4_ANOFW) Uncharacterized protein {ECO:0000313|EMBL:ACJ33165.1} KW=Complete proteome; Reference proteome OX=491915 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1). GN=Aflv_0787 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Anoxybacillus.
Sequence
MRLDIYTCSTCGEGFSVEEDKQPITCPLCESKLFEFSNTIIGSKIELDYADMELFEAYIQ
DFLRDVRGIEKIESVFTEILDEIFIEKSKEYAKNPANWGACCKWPDDDLPF
Download sequence
Identical sequences B7GIX4
WP_012574464.1.82098 gi|212638630|ref|YP_002315150.1| 491915.Aflv_0787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]