SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7HH61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7HH61
Domain Number - Region: 27-68
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00222
Family E6 C-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7HH61
Sequence length 240
Comment (tr|B7HH61|B7HH61_BACC4) Late competence protein comC {ECO:0000313|EMBL:ACK62903.1} KW=Complete proteome OX=405532 OS=Bacillus cereus (strain B4264). GN=BCB4264_A1357 OC=Bacillus cereus group.
Sequence
MFTYLYALLAGMVFGSFFMLVAVRVPLGASIITPRSHCYYCKYVLRPKELIPIISFYIQR
GCCTNCKRKIPIIYVAFECITGSIFLLTVYMIGIERELIIILSLFSLLLIISVTDYFYML
IPDCILISFAVLLILESIFVQLVTWTDSIVGSGVIFLLLYCMQKIYPEGLGGGDIKLLSL
LGFIVGVKGVFIVLFLASCFSLCFFGIGIVLKRIEVGKPIPFGPFISLGAMCYVLAAYSN
Download sequence
Identical sequences A0A0J6Z0S2 B7HH61
405532.BCB4264_A1357 gi|218234954|ref|YP_002366088.1| WP_000495724.1.10055 WP_000495724.1.67873 WP_000495724.1.76086 WP_000495724.1.76804 WP_000495724.1.95576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]