SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7KK73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7KK73
Domain Number 1 Region: 97-248
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00000000000255
Family MoCo biosynthesis proteins 0.043
Further Details:      
 
Domain Number 2 Region: 13-104
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000146
Family HtrA-like serine proteases 0.07
Further Details:      
 
Weak hits

Sequence:  B7KK73
Domain Number - Region: 250-307
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0115
Family Capz alpha-1 subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7KK73
Sequence length 448
Comment (tr|B7KK73|B7KK73_CYAP7) FeS-containing oxidoreductase {ECO:0000313|EMBL:ACK70958.1} KW=Complete proteome; Reference proteome OX=65393 OS=29155)). GN=PCC7424_2541 OC=Cyanothecaceae; Cyanothece.
Sequence
MTPTGMSKTRIRPARISKVLPNSIAAELGFEPGDAIVSINSITPRDLIDYQFLCADEFLE
LEVLDIQGKTHHLEIEKDYDEDLGLEFETALFDGLIQCNNRCPFCFIDQQPPGKRDTLYL
KDDDYRLSFLYGSYLTLTNLTEKEWTRIEQMRLSPLFVSVHATEPEIRIRLLKNRQAGKI
LDHLKWFQDRRLQIHAQVVVCPGINDGEHLEKTLLDLASFHGGDIPAVISAAVVPVGLTR
FRPPEDELTSVTEENATEVIARVQQLQTQFRQKLGTNFAWLADEWFLIARQELPPESHYE
DYPQIGNGVGSIRQFIKQFHTTAKTLLPASISPEKRLTWVVGNAVEKAFEPLVQQLNQVK
GLTVTLAPLKSNYWGQEITVTGLLTGQDLIEGLQGQDLGDSVLLPTVMLKHDEPKFLDDL
TVDDVAQQLNIPILTVSDIETLLQQCQN
Download sequence
Identical sequences B7KK73
gi|218439497|ref|YP_002377826.1| 65393.PCC7424_2541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]