SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7PL13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7PL13
Domain Number 1 Region: 3-46
Classification Level Classification E-value
Superfamily PTPA-like 0.0000000000262
Family PTPA-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B7PL13
Sequence length 57
Comment (tr|B7PL13|B7PL13_IXOSC) Phosphotyrosyl phosphatase activator {ECO:0000256|RuleBase:RU361210} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW006713 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
PGVTQEAEEPLREALPEDCRPAVVELFPYLQESFGNMTRIDYGTGEGSPLGFALGQM
Download sequence
Identical sequences B7PL13
6945.ISCW006713-PA ISCW006713-PA XP_002434461.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]