SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B7Q2E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7Q2E1
Domain Number - Region: 124-188
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000915
Family Capz beta-1 subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7Q2E1
Sequence length 315
Comment (tr|B7Q2E1|B7Q2E1_IXOSC) RIKEN cDNA gene family protein {ECO:0000313|VectorBase:ISCW020463-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW020463 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MGDSDGPCSVRDVIYLNLFDEVVLDLLEDDRERLSTVHQRLERRWLGNLKVPFSTLYLNS
KCESTEPPQLVQSAEEWQSALHTLNPQRFVKALAMDASGKWVFVPRFLRPLAPPEELSVL
AARRASSIMEGPPPKDIMSLVARFVSLIPTLSDSVFFPGLCDIWSTCDQFLQVLVGDEEE
HAILLCNFFLHLGKEAYLLLGTGIPEGQTAYVLTREGHSGGVSIWNAVTGKRYGATDSYG
PLQNVGCLVGRDNMSGFPLSMSFTDVDTVIENVLSTGVHLTEAKNAEFALAVHIHPYPSN
VLAVWVYVAVLSRKF
Download sequence
Identical sequences B7Q2E1
ISCW020463-PA XP_002410737.1.51680 6945.ISCW020463-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]