SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7QB91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B7QB91
Domain Number 1 Region: 2-28,73-119
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.0000314
Family Co-chaperone p23-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B7QB91
Sequence length 134
Comment (tr|B7QB91|B7QB91_IXOSC) Calcyclin-binding protein CacyBP, putative {ECO:0000313|EMBL:EEC16113.1, ECO:0000313|VectorBase:ISCW012295-PA} KW=Complete proteome; Reference proteome OX=6945 OS=Ixodes scapularis (Black-legged tick) (Deer tick). GN=IscW_ISCW012295 OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MVVVFLRKSSPQDWSHVTEAEKKAKEPKKIELLVSALASKNHSLVITNLMKDILPDSSYH
KVSLASPFGKPLSPDMTALVVPKPEVDSSDPSSSLMTMMKQMYDEGDDDMKRTIAKAWTE
ARDKQATGDFGGML
Download sequence
Identical sequences B7QB91
XP_002412817.1.51680 ISCW012295-PA 6945.ISCW012295-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]