SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B7VQZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B7VQZ3
Domain Number - Region: 33-118
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.00445
Family Clostridium neurotoxins, "coiled-coil" domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B7VQZ3
Sequence length 225
Comment (tr|B7VQZ3|B7VQZ3_VIBTL) Uncharacterized protein {ECO:0000313|EMBL:CAV25834.1} KW=Complete proteome; Reference proteome OX=575788 OS=Vibrio tasmaniensis (strain LGP32) (Vibrio splendidus (strain Mel32)). GN=VS_II0378 OC=Vibrionaceae; Vibrio.
Sequence
MENLSIKIPLFKTLGVITAFNAILVFGGTIASVVAVDSITAKYQSAKEDINKANMEYLKA
KNELNNVESQVKILKVLIESEINNMTKEVKDKMETAIENINASANTVSNKKDIGLIDIGS
AVKSIADKKGASLIGIDSTVKSIIDKKDAGLIVIDSALKSIADKKDVGLLDIDAAVKSIT
DKKDASLSDINISVNPILDKKRIPLSGVNTGKVEKDVVKQTNIKG
Download sequence
Identical sequences B7VQZ3
WP_012600337.1.409 575788.VS_II0378 gi|218676156|ref|YP_002394975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]