SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8A8L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B8A8L4
Domain Number - Region: 55-108
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.00131
Family MukF C-terminal domain-like 0.0051
Further Details:      
 
Domain Number - Region: 2-55
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B8A8L4
Sequence length 121
Comment (tr|B8A8L4|B8A8L4_ORYSI) Uncharacterized protein {ECO:0000313|EMBL:EEC70710.1} KW=Complete proteome; Reference proteome OX=39946 OS=Oryza sativa subsp. indica (Rice). GN=OsI_02084 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MDQHHVQQQQYVDPYRTMVLSPQPDHLNALQYNHQQQPQPPPQATPPPPQHHHASLASHF
HLLHLTTRLADAIGKGTRDQNSDALVEDLTSQFARCQQLLNSISGTLSSKSILCALMRVR
E
Download sequence
Identical sequences B8A8L4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]