SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B8JK19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8JK19
Domain Number 1 Region: 150-225
Classification Level Classification E-value
Superfamily Saposin 1.57e-18
Family NKL-like 0.014
Further Details:      
 
Domain Number 2 Region: 38-112
Classification Level Classification E-value
Superfamily Saposin 0.00000000105
Family NKL-like 0.025
Further Details:      
 
Domain Number 3 Region: 241-313
Classification Level Classification E-value
Superfamily Saposin 0.0000033
Family Swaposin 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B8JK19
Sequence length 317
Comment (tr|B8JK19|B8JK19_DANRE) Surfactant protein Bb {ECO:0000313|Ensembl:ENSDARP00000088025} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:ch211-283h6.6 OC=Cyprinidae; Danio.
Sequence
MLQFIFLNIFLFTSALSSGWARSVDPEPRITSHTMMNGMCSDCNKIVQLLTEMLSHPDSQ
HLIEKAVDRFCDEHPVIPLCMDGAKTYVHLIIRHFSAFTKENGDVCSMLGLCAVQPERKS
ASELDFSLNEQGLIYTKPSRGTGPEVRINPICNFCLLFIKTVESLLPKEKTEAAIEELLE
KICGYLPEHYEDTCNTFVKTYAKQLIELLLYSMPPHAICTALGLCLLPETPAMALSASQT
DCDSCKILAVLSQFHLGLNATDTQTSDLLNKICHLHPDAIPQCEGFVKFHGHRLLKTDGK
HPLITACLKDDLCRGQF
Download sequence
Identical sequences B8JK19
ENSDARP00000088025 ENSDARP00000088025 NP_001164537.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]