SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B8QR30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B8QR30
Domain Number 1 Region: 1108-1314
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 1.19e-28
Family Adhesin YadA, collagen-binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 322-459,494-534
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 6.54e-28
Family Adhesin YadA, collagen-binding domain 0.00026
Further Details:      
 
Domain Number 3 Region: 1302-1402
Classification Level Classification E-value
Superfamily Pili subunits 1.73e-25
Family YadA C-terminal domain-like 0.00032
Further Details:      
 
Domain Number 4 Region: 93-221
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000000000000981
Family Adhesin YadA, collagen-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  B8QR30
Domain Number - Region: 973-1080
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00301
Family Adhesin YadA, collagen-binding domain 0.019
Further Details:      
 
Domain Number - Region: 539-617
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz beta-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B8QR30
Sequence length 1402
Comment (tr|B8QR30|B8QR30_HAEPR) VtaA13 {ECO:0000313|EMBL:ACG50752.1} OX=738 OS=Haemophilus parasuis. GN=vtaA13 OC=Pasteurellaceae; Haemophilus.
Sequence
MNKIFRVIWSHAQQAWVVVSELVKSHTKTSAYTDKRAQVCTSDYFLDKQQDKFKLSLLSL
VLLGIFFSPSAAANTTNTAKPYLQDDATTSNNGYDNGTIGIGKESKASYGAIAIGQYSKA
EARHNIAIGYDTQAGNHKDHSNSVAVGNNIKIDGKEAVAIGSASKAGEGSVVLGRQASAE
KINHAVVIGHNTVVDGTEAVAIGKKSKAGKGSVVLGSDASAKNIEQAVVIGHSATASKSK
SIVIGANAKADGYGSISIGGDDLKTTKYQPDVTVQGQVQPQPQKTKITTASGGASIAIGG
GSLAKGEGSIVLGALASASKDEGIAIGANSKSTNEYGIAVGGSATATGNYAVALGWNSKG
VGTDSIAIGKSATTAGASSVVVGAHIGVTGQNLVAVGSLASAESHATALGYKASAGGMSS
VAVGDNAKTNGSAARATALGNNTVVTVGGGVALGYGSNASTAGGVEGLKQTHSVTTGEST
EANGFKSTEKVDGNKIGAVSVGLAGNKLIKRQITNVAAGKELTDAVNVAQLKSLTMLIGG
DNNSSGKVGIWEGKLTVKGENGITSYAQGSTITVKLEKDLKDKIDKIAAMGKLIKSAEKE
SNGNLKITYTDNSHSIIEKGEKGDRGETGPAGPAGPVGPAGPQGKTGPAGPAGPAGATGP
QGPKGPKGDNGDPGPKGEAGPTGPRGPAGPAGAQGIQGPKGNDGAPGARGEKGETGPAGP
EGPKGETGPAGPAGPKGEPGPKGEQGLPGPAGPAGAKGDKGDTGPAGPQGPTGPTGPQGP
TGPTGPQGPTGPTGPQGPASPTGSQGPASPTGSQGPAGPTGPAGPQGPTGPTGPAGPTGP
QGPAGPAGPQGPQGPAGPQGPAGPMGPAGPKGENVGSGLGLKDDAESNKTALTPTDAQKA
IAGDNKDGKGGLLAQTGNALNNVATVKDLQAIAQAGLDLTGNNADTTVHRPLGTKLTVEG
EGKWNGKDSAANNLYVEAQEADNKLVVKMNKDLTNLNSVTLGTATMTGDKNTINLTGAGE
KVEEEFVKWDPVTKQPILDENGNLQKYKEKVDPRVKLSGIADGDISPNSTDAVNGRQVYV
LTDRIRFFHTNDGHNAEEQINHKSNTVDSRASGSYSTAVGYKAHAKGDRAVAFGNSTLAG
IQSVAIGNVAIASGEKSIAIGDNAKAVGNQSISIGTGNVVNGNNSGAFGDPSVINADNSY
SVGNNNTIENENVFALGNKITNTTNNSVFLGTNSGYVAAGATTAGAGALESQVTGGVYNA
YAGGKATEVKGVVSVGNVDSDGKMETRRIQNVAPGLISEQSTDAINGSQLYNVAHRLGAK
LEREGRQLRAGIAATTAMSNIPQVTLPGKSTLGAGIGTFEGQNAVAVGFSRMSDNGRVIL
KVSAGATSQGKYNAGAGIALQW
Download sequence
Identical sequences A0A017QHH4 B8QR30
WP_051502691.1.45692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]