SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9EB59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9EB59
Domain Number - Region: 84-115
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0235
Family F1F0 ATP synthase subunit B, membrane domain 0.011
Further Details:      
 
Domain Number - Region: 30-62
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.0549
Family E2F dimerization segment 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9EB59
Sequence length 188
Comment (tr|B9EB59|B9EB59_MACCJ) Cell-division initiation protein homolog {ECO:0000313|EMBL:BAH17470.1} KW=Complete proteome; Reference proteome OX=458233 OS=Macrococcus caseolyticus (strain JCSC5402). GN=MCCL_0763 OC=Macrococcus.
Sequence
MKYSPEEIKLKQFNVVHKGLNENEVRNYLEELSNELETLRREKKMLDQLIADKDENINRF
KNVENTISDAILVAQRAGDEIKAAAGMQADVIIKDAKSHADLIVNDAMQKAREIAYQTED
MKRQSKIFRSRFQLLVEAQLDLLKTEDWDYLLNYELDTRPLQEDAAPQIDPAVNQGGGSV
DKNESSEN
Download sequence
Identical sequences B9EB59
WP_012656671.1.50991 gi|222151013|ref|YP_002560166.1| 458233.MCCL_0763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]