SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9FUG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9FUG8
Domain Number - Region: 56-154
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0222
Family Capz beta-1 subunit 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9FUG8
Sequence length 196
Comment (tr|B9FUG8|B9FUG8_ORYSJ) Uncharacterized protein {ECO:0000313|EMBL:EEE67675.1} OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_25313 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MATVFPYRWSRTEHLTLRPPCHGGDPLDAHQPLPWILLDVRAYIADRRNSTTAAADLGNG
HHLYRPTAAGILHLCLVHLTNKVDASDEKAVVLAVDMANKRLQTVSVYDAERIVDDFDYS
YTQSTISQYFTTAAGVKGNLKRPLKFHAQYPHKRLGETISRSDNPMDLHEPLQLDIGFGL
GTKDETEDSDNPMDLE
Download sequence
Identical sequences B9FUG8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]