SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9H7Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9H7Y8
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-73
Family Capz beta-1 subunit 0.00000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9H7Y8
Sequence length 258
Comment (tr|B9H7Y8|B9H7Y8_POPTR) F-actin capping protein beta subunit {ECO:0000313|EMBL:EEE93725.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0005s22130g OC=Populus.
Sequence
MEAAMGLMRRIHPKQSETALSALLSLLPHHSSDLLSQVDQPLQVLCDLESGKEYILCEYN
RDADSYRSPWSNKYYPPLEDALYPSSELRKLEVEANEVFAVYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKDGSKTGQGRRGHLQEGAWDAIHVIEVGPEEESMAHYCLTSTIMLSLTT
NDESSGTFSLSGSIRRQMNMDLSVADGHLCNMGRMIEEMEGKLRNSLDQVYFGKTKEMVC
TLRPPSEVVLRLPTADLA
Download sequence
Identical sequences B9H7Y8
POPTR_0005s22130.1|PACid:18208265 XP_002306729.1.11743 3694.estExt_fgenesh4_pm.C_LG_V0447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]