SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9HXT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9HXT3
Domain Number - Region: 101-125
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0863
Family Myosin S1 fragment, N-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9HXT3
Sequence length 138
Comment (tr|B9HXT3|B9HXT3_POPTR) Uncharacterized protein {ECO:0000313|EMBL:EEF00551.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0010s01600g OC=Populus.
Sequence
MSFILSPFTALLAGMMFSESSLFESSRCIPNPFSGKHWIITTVLKKWVLDVTGVCNPVGP
IGGALVGGLVSTLLDVVKVGTCAIQERYGSQTIHRVCNPGEMWVPDRTHGYVACLDKQDG
PDKVIPVLLLPTEKARQN
Download sequence
Identical sequences B9HXT3
3694.fgenesh4_pg.C_LG_X000152 POPTR_0010s01600.1|PACid:18240865 XP_002314380.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]