SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9J6F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9J6F3
Domain Number - Region: 65-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00484
Family F93-like 0.083
Further Details:      
 
Domain Number - Region: 14-64
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9J6F3
Sequence length 111
Comment (tr|B9J6F3|B9J6F3_BACCQ) Uncharacterized protein {ECO:0000313|EMBL:ACM15948.1} KW=Complete proteome OX=361100 OS=Bacillus cereus (strain Q1). GN=BCQ_PI214 OC=Bacillus cereus group.
Sequence
MSSSEIIDVLCENLNDGIWALRVLYAEGAMNKEKLWDYINQYHKDYQIENEKDYEGKKIL
PSRYALDIMTARLEGAGLISFKAIGRVRIYDVTDLGNVLIKELEKRVEKNN
Download sequence
Identical sequences A0A0J7DSI4 A0A1J9YBH0 A0A1J9ZPM2 A0A229M1T8 A0A229M347 A0A243C3U8 A0A243EQY1 A0A2C3A2Q3 A0A2K1RR87 B9J6F3 C2QLR4 C2SCU6 C2UNL6 C2Z140 C2ZGG3 C3DV84
gi|221642304|ref|YP_002533391.1|NC_011973 gi|221642304|ref|YP_002533391.1| 361100.BCQ_PI214 WP_000098927.1.101843 WP_000098927.1.11060 WP_000098927.1.13221 WP_000098927.1.13299 WP_000098927.1.16199 WP_000098927.1.16355 WP_000098927.1.17408 WP_000098927.1.18840 WP_000098927.1.19173 WP_000098927.1.20208 WP_000098927.1.20651 WP_000098927.1.21643 WP_000098927.1.23100 WP_000098927.1.23200 WP_000098927.1.23873 WP_000098927.1.24377 WP_000098927.1.24759 WP_000098927.1.26499 WP_000098927.1.26847 WP_000098927.1.27334 WP_000098927.1.27446 WP_000098927.1.31685 WP_000098927.1.3180 WP_000098927.1.32522 WP_000098927.1.33061 WP_000098927.1.35255 WP_000098927.1.39001 WP_000098927.1.39411 WP_000098927.1.39538 WP_000098927.1.40430 WP_000098927.1.43533 WP_000098927.1.43762 WP_000098927.1.45089 WP_000098927.1.46244 WP_000098927.1.46524 WP_000098927.1.47097 WP_000098927.1.47441 WP_000098927.1.48164 WP_000098927.1.48311 WP_000098927.1.48599 WP_000098927.1.49056 WP_000098927.1.49802 WP_000098927.1.50316 WP_000098927.1.51087 WP_000098927.1.52756 WP_000098927.1.55057 WP_000098927.1.55116 WP_000098927.1.57245 WP_000098927.1.58328 WP_000098927.1.59052 WP_000098927.1.59773 WP_000098927.1.61231 WP_000098927.1.61944 WP_000098927.1.62300 WP_000098927.1.64666 WP_000098927.1.65758 WP_000098927.1.65983 WP_000098927.1.67001 WP_000098927.1.67873 WP_000098927.1.68562 WP_000098927.1.69323 WP_000098927.1.69970 WP_000098927.1.73952 WP_000098927.1.7545 WP_000098927.1.76902 WP_000098927.1.77576 WP_000098927.1.77902 WP_000098927.1.782 WP_000098927.1.79043 WP_000098927.1.79252 WP_000098927.1.79658 WP_000098927.1.80571 WP_000098927.1.80649 WP_000098927.1.80955 WP_000098927.1.82986 WP_000098927.1.83938 WP_000098927.1.84422 WP_000098927.1.8450 WP_000098927.1.86082 WP_000098927.1.87627 WP_000098927.1.8923 WP_000098927.1.91080 WP_000098927.1.91615 WP_000098927.1.92347 WP_000098927.1.9623 WP_000098927.1.97561 WP_000098927.1.97617 WP_000098927.1.97842 WP_000098927.1.98604 WP_000098927.1.99266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]