SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9QLT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9QLT4
Domain Number 1 Region: 13-290
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-59
Family Capz beta-1 subunit 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9QLT4
Sequence length 329
Comment (tr|B9QLT4|B9QLT4_TOXGV) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:ESS28906.1} KW=Complete proteome; Reference proteome OX=432359 OS=Toxoplasma gondii (strain ATCC 50861 / VEG). GN=BN1205_070560 OC=Eucoccidiorida; Eimeriorina; Sarcocystidae; Toxoplasma.
Sequence
MFATGNSPVPAAMEESWIAAVSLTRRMPPKLIDRTVAGVQHLCPDLSIQLLTRVDRRLRL
CFDSEARKFFIACIYNQHGSSFRSPWTNAYIEGNDVSVLGAVPQRRIKPADNLRNLETTY
NRIFDSYRRAYYEGGVSSVYLWSLPSEDGFAGAFLVRHALDGGVSGDGPRGCWESVHVVE
VTQSTSNVHYRLTSTVMVDVDPPENAEANFYAGAMLTRTSEQSQKVTDLLTGPEVPPHIG
VIGPMIEAMEDRMRTAIERNYFAKAYSILDGMIRTRHNTKEPKKAAFFSELSSSLSLLSR
GSGGGPGSPGGRSMRGSRSFLRPRSGSDN
Download sequence
Identical sequences B9QLT4
gb|TGVEG_070560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]