SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9RFB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9RFB3
Domain Number 1 Region: 13-297
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-81
Family Capz alpha-1 subunit 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9RFB3
Sequence length 308
Comment (tr|B9RFB3|B9RFB3_RICCO) F-actin capping protein alpha, putative {ECO:0000313|EMBL:EEF49884.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_1433330 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MAEEEEEYGDVELSDKQKKEIAKWFLLNSPAGEIQFVAKDLRSVLNDERVYNEAAGDAFP
LYNKSHMVCLEFPDRSGDVLVTSYNELNKNEYLDPRTAQVAIVNHVKQVCTVVRPATDEE
LPSPYIEEFRCSLDAEILKYVGEAYPKGLCSVYCLKGKDVEGPGSNFELVVVISAVRNSP
QNFCNGSWRSVWNIEFKDDEQMLRITGKIEVGAHYFEEGNVQLDAKYDCNDETIFQAPDD
CAISIANIIRHHETEYLASLEASYSHLPDTTFKDLRRKLPVTRTLFPWHNTLQFSLTRDI
QKELGIGK
Download sequence
Identical sequences B9RFB3
XP_002512432.1.68434 30128.m008829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]