SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9SM91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9SM91
Domain Number 1 Region: 2-244
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.2e-72
Family Capz beta-1 subunit 0.000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9SM91
Sequence length 255
Comment (tr|B9SM91|B9SM91_RICCO) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:EEF35273.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_0297070 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MEAAMGLMRRIHPKQSETALSALLSLLPHHSSDLLSQVDQPLQVLCDLDSGKEFILCEYN
RDADSYRSPWSNKYYPPLEDALCPSAELRKLEIEANEVFAIYRDQYYEGGISSVYMWEDD
NEGFVGCFLVKKDGSKTGQGRRGYLQEGAWDAIHVIQVGPEEEGTAHYCLTSTVMLSLTT
NDESSGTFNLSGSIRRQMNRDLSVADGHLCNMGGMIEEMEGKLRNSLDQVYFGKTKEMVC
TLRPPSEVVMRLPSI
Download sequence
Identical sequences B9SM91
28644.m000919 XP_002527110.1.68434 XP_015579624.1.68434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]