SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9T9V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9T9V2
Domain Number - Region: 92-125
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 0.0131
Family DNA polymerase III psi subunit 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9T9V2
Sequence length 181
Comment (tr|B9T9V2|B9T9V2_RICCO) Uncharacterized protein {ECO:0000313|EMBL:EEF27362.1} KW=Complete proteome; Reference proteome OX=3988 OS=Ricinus communis (Castor bean). GN=RCOM_0260670 OC=Acalyphoideae; Acalypheae; Ricinus.
Sequence
MLRELELLPIWRARVPAPTSLLAATIVEAVATPLVAEVAVEVVAEPVVEAVTPEVVELEV
PVSIEFEQAPQALLPEVNEPLPEVAVELLVQTPWLLYCSQTEDAQSQQLLQNILRALQLP
LEVVTLYQQQLVSAQAGGGYPSPAGHAGKSFVKAGSLAGSVFVAGEICGSGGLKKSGLAR
I
Download sequence
Identical sequences B9T9V2
28496.m000060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]