SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9WKV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9WKV2
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.46e-69
Family Capz alpha-1 subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9WKV2
Sequence length 274
Comment (tr|B9WKV2|B9WKV2_CANDC) F-actin capping protein subunit alpha, putative {ECO:0000313|EMBL:CAX39652.1} KW=Complete proteome OX=573826 OS=3949 / NRRL Y-17841) (Yeast). GN=CD36_26170 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSIKLNELVDSLIQSAPPAELKQVSQSLSSLTKGTSTSSTNSLIQDSIEQYAQDNIISID
NIIISKYSKDENSSKYIDYVNNKLFNVDWSNQKIIDVEPYHNNSNGNSYNELIQKLTQYG
DDYYPSNFAFTVIPENQDQLRVIIIGQRANHDNFYTGQWKSNYLITEQEIKGNIDLDIHY
FEDGNVRLKFNESINSNNSSTLQSGNLINDSSKIVNFINEQENATMVKIVEQFNNLNQKT
FKNLRRLLPVTRSKINWGSAIGNYRLGSDVVNKK
Download sequence
Identical sequences B9WKV2
573826.CD36_26170 XP_002421713.1.45354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]