SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for B9YB15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B9YB15
Domain Number - Region: 115-196
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B9YB15
Sequence length 440
Comment (tr|B9YB15|B9YB15_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EEF66823.1} KW=Complete proteome; Reference proteome OX=545696 OS=Holdemania filiformis DSM 12042. GN=HOLDEFILI_03022 OC=Erysipelotrichaceae; Holdemania.
Sequence
MKISRKDATLFLNSSLKDQYPEISSILDHSPLPPGLTEKQFAQLPEQLKIFLEYRFISVF
KAAKEEWVQLRDIPLRKKNMSCQLCGKCPIDILAKIKNSKTNIELIVGSSCIQNYREIKG
ENGENKEEISKHNYLDNNLYLLEELDPGYIKDFERFKNIKNEVVILRDDLTRAFNNIQKK
MDKYMKMMEKKKISSLTQNELIDLRHSEIKSFFEKMEEYKNYSNTSLFGLNPKVAKWILN
HCDTNLLFEIKKEGKITANTISLIKEPDFLNRAIIKYETILKNSNMQLIARNGIRFTLIF
NENPNIKLEVNSSKFIARYKNFIFDGQKVEVDPKFILSNAKISESNSMKLVAERINKKFL
KESFTLYFEDYELDELAFKNNKNSLIYVVSYVNFINQYKDVAFYEKNKNEIVNILQQIFS
SKNKYTVKDYDEHLKDLKAN
Download sequence
Identical sequences B9YB15
WP_006060187.1.26330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]