SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0DXP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0DXP9
Domain Number - Region: 64-80
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00916
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0063
Further Details:      
 
Domain Number - Region: 32-69
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.0484
Family E6 C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0DXP9
Sequence length 95
Comment (tr|C0DXP9|C0DXP9_EIKCO) Uncharacterized protein {ECO:0000313|EMBL:EEG23230.1} KW=Complete proteome; Reference proteome OX=546274 OS=Eikenella corrodens ATCC 23834. GN=EIKCOROL_02160 OC=Neisseriaceae; Eikenella.
Sequence
MTNLSTDEALGAAAIAAHQFSFKNKAYLLPPQRCGCFSCLAIFRSTELEEGDFVPENDGQ
YTACCPYCGIDSVIGENCGYAITPELLAAMQDYWF
Download sequence
Identical sequences C0DXP9
WP_003824369.1.4837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]