SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0EBR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0EBR4
Domain Number - Region: 38-61
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00654
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0EBR4
Sequence length 110
Comment (tr|C0EBR4|C0EBR4_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EEG30975.1} KW=Complete proteome; Reference proteome OX=537013 OS=[Clostridium] methylpentosum DSM 5476. GN=CLOSTMETH_01282 OC=Ruminiclostridium.
Sequence
MRKVKITVLKTAFYKDIAEEYGKAELTPCSIMKEGQVFYADRTKPDGFCDGAWRSIYQYV
FALANGGGKEGFFYNDWAKEPGVAISCCNDGFRPVIFKLEATDEESVKDF
Download sequence
Identical sequences C0EBR4
WP_006354090.1.8017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]