SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0PRI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0PRI0
Domain Number 1 Region: 89-268
Classification Level Classification E-value
Superfamily Ferritin-like 4.61e-62
Family Ferritin 0.000017
Further Details:      
 
Weak hits

Sequence:  C0PRI0
Domain Number - Region: 27-78
Classification Level Classification E-value
Superfamily Synuclein 0.0706
Family Synuclein 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C0PRI0
Sequence length 289
Comment (tr|C0PRI0|C0PRI0_PICSI) Ferritin {ECO:0000256|RuleBase:RU361145} OX=3332 OS=Picea sitchensis (Sitka spruce) (Pinus sitchensis). GN= OC=Spermatophyta; Pinidae; Pinales; Pinaceae; Picea.
Sequence
MLLRAPAIIFSATDASSPWKQQQHNGFKKGISSDKSGVGLVATYMKTKRGAKHSVHTVRA
AGAEVKTTSALTGVVFEPFSEVQNELVLVSQSFSQSLARQKFSDSCEGALNEQINVEYNV
SYIYHALFAYFDRDNVALPGFAKYFRDASDEERGHAEMFMKYQNVRGGKVKLQSILMPTI
MEFDNSQKGEALYAMELALSLEKLTNQKLLNLHTVAQEANDGQMTDFIEGNFLTDQVQAI
KKVSEYASQLRRIGQGHGVWHFDQMLLNGGDVAPAPGAGAPGAGAPAAA
Download sequence
Identical sequences C0PRI0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]