SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0PU25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C0PU25
Domain Number 1 Region: 1-200
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-87
Family Capz alpha-1 subunit 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0PU25
Sequence length 205
Comment (tr|C0PU25|C0PU25_SALSA) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:ACN58603.1} OX=8030 OS=Salmo salar (Atlantic salmon). GN=CAZA1 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
LGNGRFFDPHNKLSFKFDHLRKEASDPQPHEGEGSLRPWRDACDSALRAYVKEHYPSGVC
TVYGKTIDGQQTIIACIEGHQFQPKNFWNGRCRSEWKFNISQSTAQVVGVLKIQVHYYED
GNVQLVSHKDVQESLTVNNETQTAKEFVKIIEDAENEYQTAISENYQTMSDTTFKALRRQ
LPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences C0PU25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]