SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C0QUV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0QUV9
Domain Number - Region: 16-124
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0034
Family Capz beta-1 subunit 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0QUV9
Sequence length 129
Comment (tr|C0QUV9|C0QUV9_PERMH) Uncharacterized protein {ECO:0000313|EMBL:ACO04948.1} KW=Complete proteome; Reference proteome OX=123214 OS=Persephonella marina (strain DSM 14350 / EX-H1). GN=PERMA_A0030 OC=Bacteria; Aquificae; Aquificales; Hydrogenothermaceae; Persephonella.
Sequence
MRTITFILLTFLSLAISQELVVGNCAENIITNKYGKFAQRFCDAYLNDKRVGMLKIEEHI
NPPFYGMVGGYLEIGNKVYKANYFTGKYFAIYEPYGNGLKIKTMCGVIYSQTDNLNEVWK
AILNCIKEQ
Download sequence
Identical sequences C0QUV9
gi|225685343|ref|YP_002729758.1|NC_012439 123214.PERMA_A0030 gi|225685343|ref|YP_002729758.1| WP_012675136.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]