SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C0R5D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C0R5D9
Domain Number - Region: 90-117
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.0144
Family ERP29 C domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C0R5D9
Sequence length 147
Comment (tr|C0R5D9|C0R5D9_WOLWR) Uncharacterized protein {ECO:0000313|EMBL:ACN94981.1} KW=Complete proteome OX=66084 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi). GN=WRi_001300 OC=Anaplasmataceae; Wolbachieae; Wolbachia.
Sequence
MALSKFLDPKLDLTFKKIFGTEKNKNILIHFLNDILGCTEVNTIQEVEFLSTIMDPEIAS
DRQSIVDVLCRDSSGSRYIIEMVRPESLRSYCLKGEEFLQKETERILKLIKPDVLPSEST
HQCESGNRLVPSDADNEPPLEKEDAQS
Download sequence
Identical sequences C0R5D9 Q4ED95
WP_007548400.1.12093 WP_007548400.1.1538 WP_007548400.1.47613 gi|225629981|ref|YP_002726772.1| 66084.WRi_001300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]