SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1BK59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1BK59
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-113
Family Capz alpha-1 subunit 0.000000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1BK59
Sequence length 286
Comment (tr|C1BK59|C1BK59_OSMMO) F-actin capping protein alpha-2 subunit {ECO:0000313|EMBL:ACO09412.1} OX=8014 OS=Osmerus mordax (Rainbow smelt) (Atherina mordax). GN=CAZA2 OC=Osmeridae; Osmerus.
Sequence
MADHDEQLSDEEKVRIAANFVIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNVD
QFTPVKVEGSEEQVLITEHGDLGNGRVLDPKKKISFKFDHLRKEASDPRPHDVDSAMEGW
RNAVDTAVRAYVKEHYQNGVCTIYGKTIDGHQTIIVCIECHQFQPKNFWNGRWRSEWKFT
ITPSTTQVAGIMKIQVHYYEDGNVQLVSHKEVQESMSISNEATTAKEFIKIMEAAENDYQ
TAINENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences C1BK59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]