SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1BMG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1BMG3
Domain Number 1 Region: 8-279
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-97
Family Capz alpha-1 subunit 0.000000066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1BMG3
Sequence length 286
Comment (tr|C1BMG3|C1BMG3_CALRO) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:ACO10216.1} OX=217165 OS=Caligus rogercresseyi (Sea louse). GN=CAPZA OC=Copepoda; Siphonostomatoida; Caligidae; Caligus.
Sequence
MGDPQKALSDTDKVRIASDFLLHSPPGEFNEVFNDVRVLLNNDTLLKEGASGAFSRYNKE
QLTPVRLESGGYCLITEYNDLGGGRFLDPRSATSFKYDHLRKEASDYQPHAPDKEWEGLR
AAIQAEATNYTLNHFKHGICCTFLVDSEENGKSIVVCIEDHQFQPKNYWNGRWRSRWTVK
LSDGEVSGILKVQVHYYEDGNVQLVTSKEVKDTLNITAKDNSSASSLAVLMERHESEYQT
AISENYQTMSDTTFKALRRQLPVTRTKIDWNKIVSYSIAKELSKNQ
Download sequence
Identical sequences C1BMG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]