SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1BVA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1BVA1
Domain Number 1 Region: 11-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-95
Family Capz alpha-1 subunit 0.0000000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C1BVA1
Sequence length 288
Comment (tr|C1BVA1|C1BVA1_LEPSM) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:ACO12954.1} OX=72036 OS=Lepeophtheirus salmonis (Salmon louse). GN=CAPZA OC=Copepoda; Siphonostomatoida; Caligidae; Lepeophtheirus.
Sequence
MGDPQEDTPVLSDTEKVRITSDFLLHSPPGEFNEVFNDVRVLLNNDTLLKEGASGAFSRY
NKDQLTPVRMEGGGYCLITEYNDLGGGWFYDARSCQSFKHDHLRKEASDYQPHTPDKEWE
PLRAAIETEATSYTLNHFKHGICCTFIADSEENGKSIVVCIEDHQFQPKNYWNGRWRSRW
SIKLSDGEVTGLLKVQVHYYEDGNVQLVTSKEVKDTLNISAKDNSSASNLAALMERYESE
YQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKIVSYSIGKELKTQ
Download sequence
Identical sequences C1BVA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]