SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1BZI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1BZI1
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.49e-34
Family Co-chaperone p23-like 0.00000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1BZI1
Sequence length 175
Comment (tr|C1BZI1|C1BZI1_ESOLU) Prostaglandin E synthase 3 {ECO:0000313|EMBL:ACO14434.1} OX=8010 OS=Esox lucius (Northern pike). GN=TEBP OC=Esociformes; Esocidae; Esox.
Sequence
MHPATAKWYDRRDSVYIEFCVADSKDVKINFEKAKFVFSCLGGIDQVKHENEVDLFEAID
QNESMHKRTDRSVLCCLRKAEPGKAWPRLTKEKAKLTWLSVDFNNWKDWEDDSDEELGNF
DRFSEVGDGDMAFNTQEAMAKMMNNMGGEDDLPDLDVADDDESADSDDEKMPDLE
Download sequence
Identical sequences C1BZI1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]