SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1C2D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1C2D3
Domain Number 1 Region: 13-179
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-53
Family Capz alpha-1 subunit 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1C2D3
Sequence length 199
Comment (tr|C1C2D3|C1C2D3_CALCM) F-actin-capping protein subunit alpha-2 {ECO:0000313|EMBL:ACO15436.1} OX=344056 OS=Caligus clemensi (Sea louse). GN=CAZA2 OC=Copepoda; Siphonostomatoida; Caligidae; Caligus.
Sequence
MGDPNEDAVPLKDADKVRIASDFLLHSPPGEFNEVFNDVRVLLNNDTLLKEGASGAFSRY
NKDQLTPVRMEAGGHYLITEYNDLGGGRFYDPRSSQSFKYDHLRKEASDYQPHTPDKEWE
TLRAAIESEATNYTLNHFKHGICCTFVVNSEENEKSIVVCIEDHQFQPQNYWNGRWLSMV
RQVSGRRGQRPSKSTGSLL
Download sequence
Identical sequences C1C2D3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]