SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1C482 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1C482
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.96e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.000099
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.32e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1C482
Sequence length 109
Comment (tr|C1C482|C1C482_LITCT) Transcription initiation factor IIA subunit 2 {ECO:0000256|PIRNR:PIRNR009415} OX=8400 OS=Lithobates catesbeiana (American bullfrog) (Rana catesbeiana). GN=T2AG OC=Aquarana.
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQINPQLALQVLLQFDKAINSALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTDLVKVGKVKIVACDGKNTGSNTAE
Download sequence
Identical sequences C1C482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]