SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1CEK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C1CEK6
Domain Number - Region: 65-203
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1CEK6
Sequence length 438
Comment (tr|C1CEK6|C1CEK6_STRZJ) Uncharacterized protein {ECO:0000313|EMBL:ACO19664.1} KW=Complete proteome OX=488222 OS=Streptococcus pneumoniae (strain JJA). GN=SPJ_1164 OC=Streptococcus.
Sequence
MRITDNQHKIIKEKFVEEYPKLSNLLLDRTLESLSQDERIFIFPNDLTHTPDLDKDQKIF
ETVNQKIKTGNVIGFLGYGQERLTISSRFSDESNDHFLHYLLNKVLYINLTSLDVALSRE
ERLYQLLMYLFPKYLQAAIRKGLYKEYHRFFHNDSNVKGVIDVRSHLKKNLPFTGNIAYA
TREFTYDNPLMQLVRHTIEYIKNQKSIGQGVLDNLSTSRENVSEIVRVTPSYKLADRAKI
TRRNQSKPIRHAYFHEYRNLQELCLMILNQEKHGLGYQDQKIYGILFDVAWLWEEYVYTL
LPKGFVHPRNKDKTDGISVFSVGKRKVYPDFYDRERKIVLDAKYKKLELTEKGINREDLF
QLISYSYILKAEKAGLIFPSMEQSVNSEIGKVAGYGAQLKKWSIRIPQNASSYSAFCKMM
ENSEENFKAIIDEEVGRK
Download sequence
Identical sequences C1CEK6
gi|225854715|ref|YP_002736227.1| 488222.SPJ_1164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]