SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1FMD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C1FMD3
Domain Number - Region: 23-94
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0602
Family Capz alpha-1 subunit 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1FMD3
Sequence length 101
Comment (tr|C1FMD3|C1FMD3_CLOBJ) Uncharacterized protein {ECO:0000313|EMBL:ACO84170.1} KW=Complete proteome OX=536232 OS=Clostridium botulinum (strain Kyoto / Type A2). GN=CLM_1678 OC=Clostridium.
Sequence
MKRGSLIIYDNSGKVWVNTGDAEGCIPPHTPPDGLPYIITEFGEFNDKIIKGIDVTVTPH
KLITEDIPHIETEEEKLKKELLKAQSEVVNLKYKEVLNNIK
Download sequence
Identical sequences A0A2I4N4W4 C1FMD3
536232.CLM_1678 536232.CLM_2638 gi|226948777|ref|YP_002803868.1| gi|226949698|ref|YP_002804789.1| WP_012704076.1.14863 WP_012704076.1.15773 WP_012704076.1.16999 WP_012704076.1.27859 WP_012704076.1.32894 WP_012704076.1.36253 WP_012704076.1.42818 WP_012704076.1.43055 WP_012704076.1.45672 WP_012704076.1.46996 WP_012704076.1.57050 WP_012704076.1.59839 WP_012704076.1.65765 WP_012704076.1.68124 WP_012704076.1.69692 WP_012704076.1.70928 WP_012704076.1.77051 WP_012704076.1.87856 WP_012704076.1.90975 WP_012704076.1.94833 WP_012704076.1.95223 WP_012704076.1.96416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]