SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C1GRX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1GRX7
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-84
Family Capz alpha-1 subunit 0.0000074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1GRX7
Sequence length 274
Comment (tr|C1GRX7|C1GRX7_PARBA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EEH38351.2} KW=Complete proteome; Reference proteome OX=502779 OS=brasiliensis). GN=PAAG_01272 OC=Paracoccidioides.
Sequence
MPSSMEIASSFIRGAPPGELSDVVAAIKNLTPEGPGLISSLAPAFEKYNEEQLATVKLPG
SSEEVIVSGYNKLGDDRYFDVQSQTSFTFDHVTQTASSPQSYVLDSQHADFIKSLFKSLS
AHAKEHYPSCSYGVYPTGNDTAVAIMLVANKYSPNNFWNGRYRAIYTIPMPSADSVTGTI
HINVHYYEDGNVSLNTKKPVSISLSPNSSAETIIKQIAAAEQAQQLELSDAFSRLSEGAF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences C1GRX7
XP_015701074.1.40148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]