SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1K7D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1K7D2
Domain Number 1 Region: 62-118
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 8.17e-29
Family Arterivirus nucleocapsid protein 0.0000431
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C1K7D2
Sequence length 123
Comment (tr|C1K7D2|C1K7D2_PRRSV) Nucleocapsid protein {ECO:0000313|EMBL:ACO06956.1} KW=Complete proteome OX=28344 OS=Porcine reproductive and respiratory syndrome virus (PRRSV). GN=ORF7 OC=Nidovirales; Arteriviridae; unclassified Arteriviridae. OH=9823
Sequence
MPNNNGKQQKKKKGNGQPVNQLCQMLGKIIAQQNQSRGRGPGKKNRKKNPEKPHFPLATE
DDVRHHFTPSERQLCLSSIQTAFNQGAGTCALSDSGRISYTVEFSLPTQHTVRLIRATAS
PSA
Download sequence
Identical sequences C1K7D2
C1K7D2_PRRSV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]