SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C2UN09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C2UN09
Domain Number - Region: 48-135
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0165
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C2UN09
Sequence length 146
Comment (tr|C2UN09|C2UN09_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EEL25664.1} KW=Complete proteome OX=526982 OS=Bacillus cereus Rock1-15. GN=bcere0018_53800 OC=Bacillus cereus group.
Sequence
MNTINKILSDFADINADEYVSNNYELSIMSESTKENIFEIAKKATFATSNDKLELIQLKD
WKKEFLICQYPNGEFSWFGKVPHGYDLKGLTSKEYIIEQLLNVFKQEPDEVYWIKLDPGS
YYACCYEEYLFKTNKGIYFFSMQVHD
Download sequence
Identical sequences C2UN09
WP_001092359.1.98604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]