SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C2WIH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C2WIH2
Domain Number - Region: 131-180
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00719
Family Occludin/ELL domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C2WIH2
Sequence length 201
Comment (tr|C2WIH2|C2WIH2_BACCE) Uncharacterized protein {ECO:0000313|EMBL:EEL57541.1} KW=Complete proteome OX=526987 OS=Bacillus cereus Rock4-2. GN=bcere0023_8590 OC=Bacillus cereus group.
Sequence
MKKYILYPLMLLTMLFLSACSNSVQPKEKNDVQSIKDVAIKVPENIFSSSKKNETINEDE
MKQNIKNYIDYSWELSENIIPLASTNSDKSFTESDREKLQKLIDLAKQNDMNFHEFISNN
NLPNDYKKPSKEIYEFMSSSTDIFVELDQELDKLAQDGNLFKANFSFTKRFEKINGRKQK
EIEKFLNEKNIKTSINSNKKN
Download sequence
Identical sequences A0A243C8F6 A0A2C0JIT4 C2WIH2
WP_000760033.1.24795 WP_000760033.1.58586 WP_000760033.1.9623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]