SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C3ECU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C3ECU7
Domain Number - Region: 25-93
Classification Level Classification E-value
Superfamily Stathmin 0.00667
Family Stathmin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C3ECU7
Sequence length 113
Comment (tr|C3ECU7|C3ECU7_BACTU) Uncharacterized protein {ECO:0000313|EMBL:EEM44625.1} KW=Complete proteome OX=527027 OS=Bacillus thuringiensis serovar pakistani str. T13001. GN=bthur0005_55930 OC=Bacillus cereus group.
Sequence
MVYKVQLQQGKGILPAKPKSQMTLEGTTYQIYHSSTKMRMDRIKALSDVQKANIKEEDIQ
EQVRYYEKKKTFSEKIIVKRKEKAKRYEVLSGYASYQAAKKIKPRHIDVTVVK
Download sequence
Identical sequences A0A0D1RKM1 C3ECU7
WP_004410222.1.18914 WP_004410222.1.23540 WP_004410222.1.36221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]