SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4IKA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4IKA6
Domain Number - Region: 57-135
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0615
Family Clostridium neurotoxins, "coiled-coil" domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4IKA6
Sequence length 201
Comment (tr|C4IKA6|C4IKA6_CLOBU) Uncharacterized protein {ECO:0000313|EMBL:EEP54966.1} KW=Complete proteome; Reference proteome OX=632245 OS=Clostridium butyricum E4 str. BoNT E BL5262. GN=CLP_1289 OC=Clostridium.
Sequence
MNYGIVKYGADLTLNEELLKDYPFDLSKYVPLFIYNGDIFNKIYKVQEYQLSYLAIQTED
LLNQGIVDTATWGLTAWEEEYGIITNLNSSYEERREVIKAKKRGQGTCTKSLIKNVAEAF
SGGECRVIENTAPYTFTIQFIGVKGIPKNMSGLRGAIDDIKPAHLVYDFKYTYTSWGYLD
SKNLSWKNAEALTWEELEIYE
Download sequence
Identical sequences C4IKA6
WP_003409165.1.14886 WP_003409165.1.36360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]