SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4IM90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4IM90
Domain Number - Region: 11-41
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00288
Family Occludin/ELL domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4IM90
Sequence length 150
Comment (tr|C4IM90|C4IM90_CLOBU) Putative methyl-accepting chemotaxis sensory transducer {ECO:0000313|EMBL:EEP52721.1} KW=Complete proteome; Reference proteome OX=632245 OS=Clostridium butyricum E4 str. BoNT E BL5262. GN=CLP_0269 OC=Clostridium.
Sequence
MIDISRKMMDEYSNLITDEKEQAYYSDFNRNYDTYLGYSRRALELSKNEEYEVSKSIANM
SQDTYDVSQDAVVGMINLKTIDEISSISNNTVVDTINIISDIAKNTDVRSQTVVDATEGQ
IIAIETVVKEIKNLSNLENKLKIITTKFKI
Download sequence
Identical sequences C4IM90
WP_003410174.1.14886 WP_003410174.1.36360 WP_003410174.1.64220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]