SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4M096 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4M096
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-84
Family Capz beta-1 subunit 0.000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C4M096
Sequence length 276
Comment (tr|C4M096|C4M096_ENTHI) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:EAL47477.1} KW=Complete proteome; Reference proteome OX=5759 OS=Entamoeba histolytica. GN=EHI_005020 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MSQTDPLDYALDLMRRLPPQKVEDNLQMLIDLCPDLTDDLLSATDQPLKIVEDTTAKKSF
LICDYCRDGDSYRSPFSNKYFPAFPEGGLPSDELRQLEISLNDAFDMYREMYYEGGVHSV
YCWDIDDGFAVCVLMKKTADQSKKGNPMKGTWDSINVIEVIPKGTSKAEYRLTSTVILYM
ETDCEATGKVAFAGSLTRQNEKVLSTTQKDSHIINIGTFVEETESRMRQILDAIYFSKSK
EITNNCRCQIGVSEQNKRTLMTKQINTQLRGRHDDD
Download sequence
Identical sequences A0A175JM88 C4M096
gi|56469757|gb|EAL47477.1| gi|67474228|ref|XP_652863.1| jCVI|EHI_005020 294381.C4M096 XP_652863.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]