SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4R4W0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4R4W0
Domain Number 1 Region: 4-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.94e-79
Family Capz beta-1 subunit 0.000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C4R4W0
Sequence length 281
Comment (tr|C4R4W0|C4R4W0_KOMPG) Beta subunit of the capping protein (CP) heterodimer (Cap1p and Cap2p) {ECO:0000313|EMBL:CAY70596.1} KW=Complete proteome; Reference proteome OX=644223 OS=pastoris). GN=PAS_chr3_0548 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
Sequence
MSQEVYEAALDLLRRLDAKNISKHLTNICKLNPDLAEDLLSSVDVPLTTKQCAESGKQYL
ACDYNRDGDSYRSPWSNKYYPALEDEEDAPFPSKTLREAEIFANSSFDVYRDLYFEGGIS
SVYLWDIDEDGNDVSKDGKIGFAGVVLIKKEVDAGKSGSWDSIHVFEVQPNESGPYATYR
ITSTIILDLSAGKSEDQLLELSGNLTRQTEKDLKYQDLSSHISNVGSMVEDIESKQRNML
QEVYFGKTKDVIGDLRTTKGISSLKEESEKQSELIQGMRNL
Download sequence
Identical sequences C4R4W0 F2QW37
XP_002492775.1.19831 644223.PAS_chr3_0548 gi|254571331|ref|XP_002492775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]