SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C4STL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C4STL2
Domain Number 1 Region: 38-99
Classification Level Classification E-value
Superfamily Protein HNS-dependent expression A; HdeA 0.0000196
Family Protein HNS-dependent expression A; HdeA 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4STL2
Sequence length 114
Comment (tr|C4STL2|C4STL2_YERFR) Acid stress chaperone HdeB {ECO:0000256|HAMAP-Rule:MF_00947} KW=Complete proteome OX=349966 OS=Yersinia frederiksenii ATCC 33641. GN=DJ58_3846 OC=Yersiniaceae; Yersinia.
Sequence
MSYKSLRNIALTGLLLSAAATTFAATPTTTSATATTPSDMTCKEFLDLNPKSFTPVVYWV
LNDDTQYKKGDYVDFHETDTIVTPKVVEVCKKSPESKLSEMKQDILNFAKKHHM
Download sequence
Identical sequences A0A0T9UE53 C4STL2
WP_004711572.1.101998 WP_004711572.1.16645 WP_004711572.1.31514 WP_004711572.1.35815 WP_004711572.1.36457 WP_004711572.1.43549 WP_004711572.1.48104 WP_004711572.1.6436 WP_004711572.1.72462 WP_004711572.1.73755 WP_004711572.1.73966 WP_004711572.1.7618 WP_004711572.1.77398 WP_004711572.1.94615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]