SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C4YIH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C4YIH4
Domain Number - Region: 47-121
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz alpha-1 subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C4YIH4
Sequence length 142
Comment (tr|C4YIH4|C4YIH4_CANAW) Uncharacterized protein {ECO:0000313|EMBL:EEQ45909.1} KW=Complete proteome OX=294748 OS=Candida albicans (strain WO-1) (Yeast). GN=CAWG_04249 OC=Candida/Lodderomyces clade; Candida.
Sequence
MSSDPLTSNARPATDSLITVRIIKSFPYRNVKNYIIKDIDLKSTTPKQLLEKLHEIINTT
GALRPYRNVEYNSIKIYTKAHGSKSMNLVINFDNDEDWVLVNPSNNGDKQSLWDLDIRNE
TELSLFNWDDYVAYKENPVEKW
Download sequence
Identical sequences C4YIH4
5476.CAL0005853 CAWT_04249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]